download process
Found in
Documents / eBooks
Business
Educational
eBooks
Audio Books / Teaching
Movies
Video Tutorials
Pictures / Graphics
Abstract
Miscellaneous
Software / Programs
Business
Internet/Network
Miscellaneous
Utilities
Website Promotion
Development
HTML / xHTML
PHP
Perl / CGI
Templates / Flash

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable for maximum fun
Sign up

"Customizable" downloads

Thumbnail 35 Customizable Header Graphics with PLR MRR

35 Customizable Header Graphics With Plr Mrr

35 Customizable Header Graphics with PLR MRR. Dear Friend: This Pakage Contains: 1. 35 Header Graphics 2. Background 3. Buttons 4. Vide......

Add To Basket
4.00 USD
Thumbnail Ultimate Header Graphics Pack + 2 Mystery BONUSES!

Ultimate Header Graphics Pack + 2 Mystery Bonuses!

Get 4 High-Quality Header Graphics Packages, along with two Mystery BONUSES! Listed below are the 4 header graphics packages you will...
1. 21 Header Graphics Templates - FULLY Customizab...
play button

568.07 MB

Add To Basket
10.99 USD
Thumbnail Ultimate E-cover Templates Pack + 2 Mystery BONUSES!

Ultimate E-cover Templates Pack + 2 Mystery Bonuses!

Get 3 HOT E-cover Template Packages, along with two Mystery BONUSES! Listed below are the 3 e-cover template packages you will...
1. 21 Header Graphics Templates - FULLY Customizab...
play button

281.63 MB

Add To Basket
4.99 USD
Thumbnail Ultimate Photoshop Action Scripts Pack + 2 Mystery BONUSES!

Ultimate Photoshop Action Scripts Pack + 2 Mystery Bonuses!

Get 5 High-Quality Photoshop Action Scripts Packages, along with two Mystery BONUSES! Listed below are the 5 photoshop action scripts packages...
1. 21 Header Graphics Templates - FULLY Customizab...
play button

554.05 MB

Add To Basket
8.99 USD
Thumbnail 6 Customizable Flash Websites for Healthcare

6 Customizable Flash Websites For Healthcare

These sites are completely & professionally built, customizable with layout and design done on each page. A great opportunity for...

Add To Basket
9.95 USD
Thumbnail Customizable Embedded Processors

Customizable Embedded Processors

Customizable processors have been described as the next natural step in the evolution of the microprocessor business: a step in...

ePub format
apps only,
non-refundable!

Add To Basket Angebot von BuchIO.de
88.30 EUR (113.32 USD)
Thumbnail TextSpeech Pro Elements for Windows

Textspeech Pro Elements For Windows

Unleash the power of spoken text with TextSpeech Pro Elements. Convert text, emails, web pages and documents (RTF, Word, PDF,...

Add To Basket
59.99 USD
Thumbnail Ultimate Copywriting Secrets Pack + 2 Mystery BONUSES!

Ultimate Copywriting Secrets Pack + 2 Mystery Bonuses!

Get 16 HOT products on Offline Marketing, along with two Mystery BONUSES! If you want to make money from offline marketing,...
1. HowKillerPromotionalPLR fy7565y.zip
play button

347.04 MB

Add To Basket
22.99 USD
Thumbnail Ultimate Internet Marketing Scripts Pack + 2 Mystery BONUSES

Ultimate Internet Marketing Scripts Pack + 2 Mystery Bonuses

Get 18 HOT Internet Marketing Scripts, along with two Mystery BONUSES! Listed below are the 18 internet marketing scripts you will...
1. Exponential Profit Multiplier with 2 MYSTERY BO...
play button

342.36 MB

Add To Basket
25.99 USD
Thumbnail Ultimate Membership Site Pack + 2 Mystery BONUSES

Ultimate Membership Site Pack + 2 Mystery Bonuses

Get 10 HOT Products on Membership Sites, along with two Mystery BONUSES! Listed below are the 10 products on membership sites...
1. WP Padlock Pro Video Instructions.zip
play button

1909.33 MB

Add To Basket
12.99 USD
Thumbnail 10 Website Templates Pack - with 2 Mystery BONUSES!

10 Website Templates Pack - With 2 Mystery Bonuses!

Comes with two UNANNOUNCED BONUSES! You Will Get 10 Website Templates: - Each template comes in 5 different flavors, meaning that you...
1. 21HeaderTemplates fh65yt6 bonuss.zip
play button

10websitetemplates-hfgdrd.zip   62.92 MB

Add To Basket
6.99 USD
Thumbnail 65 Most Needed PHP SCRIPTS

65 Most Needed Php Scripts

65 Most Needed PHP SCRIPTS 1) Expired Domain Finder Script: This PHP script has become a very hot item within the last...

Add To Basket
4.00 USD
Thumbnail Facebook Clone

Facebook Clone

Facebook Clone. New Facebook Clone Script. This is a social networking site and the script is made available to everyone and...

Add To Basket
9.99 USD
Thumbnail 67 Header Graphics.zip

67 Header Graphics.zip

Had Enough Of Paying Someone Else To Do Professional Header Graphics? Want An Instant Easy Solution? Within just 5 minutes you can...

Add To Basket
3.99 USD
Thumbnail Slide Up Fx With MRR!

Slide Up Fx With Mrr!

Discover a New, Breakthrough Way to Increase Your Opt-ins by 5, 10, 25 percent Watch Your Sales Skyrocket Without doing...

Add To Basket
1.85 USD
Thumbnail Auction Script 5 green

Auction Script 5 Green

New Admin Features: * Add Polls & Surveys * Add Articles ...

Add To Basket
10.00 USD
Thumbnail Slide Up FX - MRR

Slide Up Fx - Mrr

Discover a New, Breakthrough Way to Increase Your Opt-ins by 5, 10, 25 Watch Your Sales Skyrocket Without doing...

Add To Basket
3.00 USD
Thumbnail Swoopo_Clone_Script_German_Template_Desing

Swoopo_clone_script_german_tem plate_desing

New Swoopo Clone script Premium Website German template desing Customizable Template Customizable Template Customizable Template Following Langauage-Fi......

Add To Basket
7.00 EUR (8.98 USD)

Similar tags: affiliateautoresponderbody languagebusinessclickbankcoursegraphicsmake moneymakermarketingminisitepackprivate label rightsresellscriptsoftwaretemplateswebsite Top tags: sound effectsgames shopservice repair manualyamaha