download process

"Sales Letter Templates" downloads in ebooks

Thumbnail How To Write Sales Letters

How To Write Sales Letters

How To Write Sales Letters - Is Your Sales Page a Profit Sucking, Dead- in-the-Water, Band-Width Eating, Online Dud? DONT DELETE...

9.00 USD
Thumbnail Super Effect Sales Pages

Super Effect Sales Pages

Is Your Sales Page a Profit Sucking, Dead- in-the-Water, Band-Width Eating, Online Dud? DON'T DELETE YOUR ONLINE EMPIRE JUST YET! Spruce Up...

4.77 USD
Thumbnail A-Z of Super-Effective Sales Pages

A-z Of Super-effective Sales Pages

Is Your Sales Page a Profit Sucking, Dead- in-the-Water, Band-Width Eating, Online Dud? DON'T DELETE YOUR ONLINE EMPIRE JUST YET! Spruce Up...

4.99 USD
Thumbnail 306 Web Design Templates

306 Web Design Templates

597 Ready To Use Sales Letters and Business Forms . . . 597 Business Letters LibraryAt your fingertips, just about every...

19.95 USD
Thumbnail 5 HTML Templates Pack Vol.16 PLR

5 Html Templates Pack Vol.16 Plr

Ready to use, HTML templates for following 5 niches * 404 Eror Page With Links * Domain For Sale * Free Resources * Online...

1.49 USD

Similar tags: copywritinggraphicsmarketingminisiteminisite templatesphotoshop templatepsdpsd graphicspsd templatesresellsalessales lettersales letter templatessales pagetemplatesweb templateswebsite Top tags: sound effectsgames shopservice repair manualyamaha