download process
Found in
Documents / eBooks
Business
Educational
eBooks
Movies
Educational
Video Tutorials
Software / Programs
Website Promotion
Video Tutorials

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable for maximum fun
Sign up



For the latest updates,
enter your email address:

Delivered by FeedBurner


"Transferring Web Hosting" downloads

Thumbnail Domain Names - 25 PLR Articles Pack!

Domain Names - 25 Plr Articles Pack!

High Quality Content! 25 Domain Names Private Label Articles Topics:- Cybersquatting and Your Domain Name Domain Name Arbitration Transferring Dom......


Preview
1.49 USD
Thumbnail Make My Own Business Website

Make My Own Business Website

VERSION 3 JANUARY 2010 Introduction 4 1. Choosing The Right Domain Name 6 8 11 14 17 18 21 23 30 10. 32 38 43 44 46 49 51 57 58 2. Usi......

7.00 USD
Thumbnail Run Your Business Using Google

Run Your Business Using Google

Attention : Small business operators, online business owners, webmasters and others trying to find a better way to manage remote...

4.99 USD
Thumbnail Ultimate Blogging Secrets Pack2 + 2 Mystery BONUSES!

Ultimate Blogging Secrets Pack2 + 2 Mystery Bonuses!

Get 10 HOT products on Blogging, along with two Mystery BONUSES! If you want to know how to make money from...
1. WordPress AutoBlogging Script with An UNANNOUNC...
play button

1795.5 MB

16.99 USD
Thumbnail Ultimate Domain Name Marketing Secrets Pack+Mystery BONUSES!

Ultimate Domain Name Marketing Secrets Pack+mystery Bonuses!

Get 4 HOT products on Domain Name Marketing, along with two Mystery BONUSES! If you want to make money from domain...
1. HowSellDomainsEbayPLR 5j57575y.zip
play button

143.03 MB

4.99 USD
Thumbnail FTP Know How

Ftp Know How

Getting your website up and running using FTP has never been easier! Now you can... "Setup Your Website, Transfer Files, and...

9.99 USD
Thumbnail FTP Warm Up with Private Label Rights

Ftp Warm Up With Private Label Rights

VelocitySpark.net ExclusiveAnnouncing The Brand New, 11 Part, Step By Step Video Course :: "Finally, Discover How You Too Can Quickly and...

9.99 USD
Thumbnail FTP Warm Up - Video Series plr

Ftp Warm Up - Video Series Plr

Author's Summary (see demo video here) Most people don't know how to go from creating a files to getting it on their...

4.99 USD
Thumbnail Run Your Business Using GOOGLE MRR

Run Your Business Using Google Mrr

Attention : Small business operators, online business owners, webmasters and others trying to find a better way to manage remote...

6.49 USD
Thumbnail *New* Run Your Business Using Google

*new* Run Your Business Using Google

Attention : Small business operators, online business owners, webmasters and others trying to find a better way to manage remote...

5.00 USD
Thumbnail Turbo Training System

Turbo Training System

Struggling To Get Started Online Simply Because You Don't Know How To Do The Simple Tasks?... Our Turbo Training System Will...

17.00 USD

Similar tags: businessdomaindownload ebookebooksfileftp mrrgooglegoogle appsguidehow tohow to ftpmarketingsecretstransfervideo tutorialweb designwordpress Top tags: sound effectsgames shopservice repair manualyamaha