download process
Found in
Documents / eBooks
Business
Manuals & Technical
Story / Literature
Educational
eBooks
Audio Books / Teaching
Movies
Video Tutorials
Music
MP3 (all)
Inspirational
Miscellaneous
Video Tutorials
Software / Programs
Business
Internet/Network
Utilities
Website Promotion
Video Tutorials
Sounds / MIDI
Natural Ambience
Misc.


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"And Brain Research Your" downloads

Thumbnail Brain Research And Your Child

Brain Research And Your Child

How Brain Friendly Learning Can Release Your Child's Infinite Potential! Such minds should be exposed to enchanted learning experiences where learning...

Download
3.99 USD
Thumbnail Online Branding Secrets - Mrr!

Online Branding Secrets - Mrr!

Leapfrog Over All Your Competitors With These Simple Branding Secrets You Can Apply Immediately! Discover Simple Yet Powerful Techniques Successful Marketers...

Download
6.99 USD
Thumbnail Delta Drive

Delta Drive

Delta Drive The slowest and most relaxing brain state is called delta state. Here the brain waves are of the greatest...
Sample
play button

Download
20.98 USD
Thumbnail Boredom Basher

Boredom Basher

"Surefire Ways To Build Up Your Original Thinking And Beat Boredom!" This Book Is One Of The Most Valuable Resources In...

Download
4.99 USD
Thumbnail Brainwork - David A. Sousa

Brainwork - David A. Sousa

Through engaging stories and studies, the author shows you how to leverage the most provocative brain research to increase your...

ePub format
apps only,
non-refundable!

Download
23.99 USD

Similar tags: brainbrainstorm domain generatorbusinessdownloadeconomicseducationfamilygeneralhealthhelpmarketingmoneymrronline branding dominationplrpsychologyrelationshipsself Top tags: sound effectsgames shopservice repair manualyamaha