download process
Found in
Documents / eBooks
eBooks
Software / Programs
Business
Development
Javascript


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Appraisal Domain Software Tradebit" downloads

Thumbnail Ultimate Domain Name Marketing Secrets Pack+Mystery BONUSES!

Ultimate Domain Name Marketing Secrets Pack+mystery Bonuses!

Get 4 HOT products on Domain Name Marketing, along with two Mystery BONUSES! If you want to make money from domain...
1. HowSellDomainsEbayPLR 5j57575y.zip
play button

143.03 MB

Download
4.99 USD

Similar tags: appraisalcertified appraisaldomaindomain appraisal scriptdomain appraisal softwareflippingmarketingsecretsset a price on domain namewebmasters Top tags: sound effectsgames shopservice repair manualyamaha