download process
Found in
Pictures / Graphics
Abstract
Architecture
People
Places
Sports
Transportation


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Closeup Detail Flag Flags" downloads

Thumbnail spanish flag

Spanish Flag

Photoalbum: spanish flag Author: Ernst Wrba Date: 2007-04-01 Maximum available size: 18 Mpix.(5208 x 3463 pix.) Lowest (724x469 pix.) resolution ......

Download
49.00 EUR (57.71 USD)
Thumbnail German flag

German Flag

Royalty free photos: German flag Author: AnjuDate: 2007-09-04 Maximum available size: 18.7 Mpix.(5291 x 3528 pix.) Lowest (724x469 pix.) resolution ver......

Download
49.00 EUR (57.71 USD)
Thumbnail Bicycle bell, American flag motif

Bicycle Bell, American Flag Motif

Photografie: Bicycle bell, American flag motif Author: Ingeborg KnolDate: 2011-08-20 Royalty Free photo versions - Maximum available size: 18.2 Mpix.(5231......

Download
49.00 EUR (57.71 USD)
Thumbnail Detail, German flag

Detail, German Flag

Royalty free: Detail, German flag Author: Sylvia WestermannDate: 2004-09-12 Maximum available size: 18.2 Mpix.(5222 x 3481 pix.) Lowest (724x469 pix.) ......

Download
49.00 EUR (57.71 USD)
Thumbnail CD with a Swiss flag

Cd With A Swiss Flag

Photo Gallery: CD with a Swiss flag Author: Michaela BegsteigerDate: 2010-03-26 Maximum available size: 18.5 Mpix.(5277 x 3511 pix.) Lowest (724x469 pi......

Download
49.00 EUR (57.71 USD)
Thumbnail Granada, Andalusia, Spain

Granada, Andalusia, Spain

Royalty free photos: Granada, Andalusia, Spain Author: Ricardo Demurez Date: 2007-04-07 Maximum available size: 18 Mpix.(3473 x 5188 pix.) Lowest......

Download
49.00 EUR (57.71 USD)
Thumbnail little pinning flags

Little Pinning Flags

Photo cd: little pinning flags Author: Fred Proksch Date: 2006-10-21 Maximum available size: 18.3 Mpix.(5241 x 3494 pix.) Lowest (724x469 pix.) r......

Download
49.00 EUR (57.71 USD)

Similar tags: agedalbrecht weißerargentinesasiacloseclose-upclose-upscloseupcloseupsdaytimedetaildetailsensignfemaleflagmakroaufnahmephotosshots Top tags: sound effectsgames shopservice repair manualyamaha