download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
eBooks
Audio Books / Teaching
Movies
Educational
Video Tutorials
Music
MP3 (all)
Video Tutorials
Software / Programs
Business
Internet/Network
Website Promotion
Video Tutorials
Graphics Software
Development
PHP
ASP
Misc.


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Domain Host Video Website" downloads

Thumbnail IM Video Vault (MRR)

Im Video Vault (mrr)

Dear Friend, Do you find it difficult to make money online because there are simply so many nitty gritty stuff that...

Download
5.99 USD
Thumbnail The

The

This is your chance to take your newbie "green-ness" and turn it into pure "gold". And for a GIGANTIC SAVINGS...
1. How To Sell Information Products On Ebay - FULL...
play button

71.3914 MB

Download
16.00 USD
Thumbnail YOUR VIDEO COURSE with MRR

Your Video Course With Mrr

YOUR VIDEO COURSE "Would You Like The Blueprint To Building Your Own Online Business That Will Beat Any Recession?" I want to...

Download
9.69 USD
Thumbnail cPanel Tutorals

Cpanel Tutorals

Sick and tired of being bogged down by web hosting tasks? Discover How to Use cPanel To Maximize Your Online Profits...

Download
4.50 USD
Thumbnail Physical Product Profits

Physical Product Profits

If you're not bringing in the commissions you want from digital products, then pay attention... Discover The Simplest & Fastest Way...

Download
9.99 USD
Thumbnail Celebrity Blogging

Celebrity Blogging

Breakthrough Step-By-Step Secret Methods Finally Caught On Video... Showing How Average Joes & Janes Turn Into Power-House, Celebrity Blogging Pros! Learn...

Download
3.99 USD
Thumbnail 25 web Hosting PLR articles, #142

25 Web Hosting Plr Articles, #142

salvador.tradebit.com presents 25 web Hosting PLR articles, #142All web Hosting articles are top notch, professionally written and come with private...

Download
2.99 USD
Thumbnail Its You Live

Its You Live

Innovative New Technologies Let You Harness The Power Of The Stars To Create Content, Increase Traffic, Sell More Products & Make More Money Online! A...

Download
9.97 USD
Thumbnail Webhosting For Newbies

Webhosting For Newbies

Webhosting For Newbies "Discover How To Finally Get a Webhosting Account and Work Your Way Around It Without Any Hassles..." You'll Finally...

Download
7.20 USD

Similar tags: bloggingcashcelebrity bloggingcheap ebookscpanelcpanel tutorialsebookflipping websitesim video vaultinternet marketingmarketingscriptsecretstrafficvideowebhostingwordpressyoutube Top tags: sound effectsgames shopservice repair manualyamaha