download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
eBooks
Recipes & Cooking
Audio Books / Teaching
Music
MP3 (all)
Country
Inspirational
Pop
Software / Programs


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Health Healthy Happy Life" downloads

Thumbnail *NEW!* How To Loose Weight Fast eBooks Collection Tips

*new!* How To Loose Weight Fast Ebooks Collection Tips

This collection contains the following products: *NEW!* The Low Fat Way to Health and Longer Life *NEW!* One Month Diet Plan: Eat...
1. *NEW!* 101 Tips to Lose Weight Quickly | 101
play button

3.69478 MB

Download
Preview
55 USD
Thumbnail Protein: Protein Food - Cathy Wilson

Protein: Protein Food - Cathy Wilson

Protein: Protein Food by certified trainer, nutritionist, and author Cathy Wilson contains proven strategies and take action steps on how...

ePub format
apps only,
non-refundable!

Download
3.99 USD
Thumbnail Nutrients for Kids

Nutrients For Kids

"Get All The Support And Guidance You Need To Get The Right Nutrition For Your Kids!" This Book Is One Of...

Download
6.99 USD
Thumbnail Heal Yourself

Heal Yourself

Discover the seven keys to living a more fulfilling, healthy and wealthy life. You will find out how to finally...

Download
Preview
5.7 USD
Thumbnail Personal Brilliance

Personal Brilliance

Do you ever feel as though your life simply isnt going the way you would like? Are there issues in...

Download
9.95 USD
Thumbnail Ultimate Dating and Relationship Secrets Pack + 2 BONUSES!

Ultimate Dating And Relationship Secrets Pack + 2 Bonuses!

Get 14 HOT products on Dating and Relationships, along with two Mystery BONUSES! If you want to make money from the...
1. 101 Steps to A Happy Relationship - MRR + 2 Mys...
play button

131.6 MB

Download
14.99 USD

Similar tags: articles plrbetter lifedietdownloadebookfamilyfitnessgeneralhealthmindmp3 albummrrplrplr articlespregnancy nutritionrelationshipsweight loss Top tags: sound effectsgames shopservice repair manualyamaha