download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
eBooks
Audio Books / Teaching
Movies
Video Tutorials
Software / Programs
Business
Internet/Network
Website Promotion
Video Tutorials


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Best Viral Marketing" downloads in documents / ebooks

Thumbnail Video Marketing Secrets

Video Marketing Secrets

Video Marketing Secrets: How to Use Videos to Grow Your Business If You Dont Adopt Video Marketing Now, You Run the...

Download
21.00 USD
Thumbnail Ultimate Viral Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Viral Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Viral Marketing, along with two Mystery BONUSES! If you want to know how generate FREE traffic...
1. Exponential Profit Multiplier with 2 MYSTERY BO...
play button

627.02 MB

Download
15.99 USD
Thumbnail Ultimate Facebook Marketing Secrets Pack2 +2 Mystery BONUSES

Ultimate Facebook Marketing Secrets Pack2 +2 Mystery Bonuses

Get 7 HOT products on Facebook Marketing, along with two Mystery BONUSES! If you want to make money from Facebook marketing,...
1. Facebook Cash Cow+BONUS!
play button

626.43 MB

Download
8.99 USD
Thumbnail The Ultimate Online Marketing Collection - Mrr

The Ultimate Online Marketing Collection - Mrr

This is a collection of the best tools, ebooks, courses, scripts and recourses for online marketers. This package contains over 300...
1. The ultimate traffic guid - drive traffic to yo...
play button

107.187 MB

Download
33.50 USD
Thumbnail 30 HOT Reports - with FULL Private Label Rights + 2 BONUSES

30 Hot Reports - With Full Private Label Rights + 2 Bonuses

Comes with FULL Private Label Rights, and two Mystery BONUSES! Get 30 Smoking Hot Niche Reports - Complete With *FULL* Private...
1. Secret Marketing Strategies Volume 1
play button

12.18 MB

Download
6.99 USD
Thumbnail Ultimate Niche Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Niche Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Niche Marketing, along with two Mystery BONUSES! If you want to make money from niche marketing,...
1. HowtoArticleDirPLR rkjy5y55.zip
play button

1902.93 MB

Download
12.99 USD
Thumbnail Ultimate PLR Marketing Secrets Package + 2 Mystery BONUSES!

Ultimate Plr Marketing Secrets Package + 2 Mystery Bonuses!

Get 6 HOT products on "Private Label Rights" Marketing, along with two Mystery BONUSES! If you want to make money from...
1. HowToUseClickB ijygrrf5r5.zip
play button

61.61 MB

Download
5.99 USD
Thumbnail Ultimate Youtube Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Youtube Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Youtube Marketing, along with two Mystery BONUSES! Listed below are the 9 products you will get...
1. YouTubeMarketing jtgt56u5u.zip
play button

850.2 MB

Download
9.99 USD
Thumbnail Ultimate Video Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Video Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Video Marketing, along with two Mystery BONUSES! If you want to make money from video marketing,...
1. InternetMarketingAutoPLR ggg655j5j56.zip
play button

607.61 MB

Download
10.99 USD
Thumbnail Ultimate Domain Name Marketing Secrets Pack+Mystery BONUSES!

Ultimate Domain Name Marketing Secrets Pack+mystery Bonuses!

Get 4 HOT products on Domain Name Marketing, along with two Mystery BONUSES! If you want to make money from domain...
1. HowSellDomainsEbayPLR 5j57575y.zip
play button

143.03 MB

Download
4.99 USD
Thumbnail Ultimate PPC Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Ppc Marketing Secrets Pack + 2 Mystery Bonuses!

Get 4 HOT products on Pay Per Click Marketing, along with two Mystery BONUSES! If you are interested in Pay Per...
1. GoogleAdwordsandAdsense kh7thn5756.zip
play button

73.4 MB

Download
3.99 USD

Similar tags: affiliate marketingarticlearticle marketinginternet marketingmake moneymake money onlinemake more moneymarketingsecretstrafficvideo marketingvideo marketing secretsvideo marketing strategiesviralviral marketingviral trafficviral traffic generation Top tags: sound effectsgames shopservice repair manualyamaha