download process
Found in
Documents / eBooks
Business
Educational
eBooks


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Bussiness Ideas" downloads

Thumbnail Profit Funnel Ideas

Profit Funnel Ideas

1. THE PROFIT FUNNEL PLAN Learn how to a successful online business profit funnell looks like- and how you can model...

Download
7.00 USD
Thumbnail PLR For Newbies Video Series

Plr For Newbies Video Series

Discover The Secrets Of How To Create High-Demand, Quality Digital Products Without Wasting Thousands of $$$ & Countless Hours By Using Private...

Download
31.00 USD
Thumbnail Home Sweet Home with MRR

Home Sweet Home With Mrr

"Discover 15 Perfect Home Businesses You Can Start On A Shoestring Budget" Turn Your Passion And Skills Into A Real Life...

Download
9.00 USD
Thumbnail Ultimate Domain Name Marketing Secrets Pack+Mystery BONUSES!

Ultimate Domain Name Marketing Secrets Pack+mystery Bonuses!

Get 4 HOT products on Domain Name Marketing, along with two Mystery BONUSES! If you want to make money from domain...
1. HowSellDomainsEbayPLR 5j57575y.zip
play button

143.03 MB

Download
4.99 USD
Thumbnail Domain Flipping Treasure Map

Domain Flipping Treasure Map

"If you are looking for a no-risk method of making a living online, it just doesn't get better than this!" Buying...

Download
23.00 USD

Similar tags: bussinessbussiness ideasdomainflippinghappyhealthymarketingmoneymrronline bussinessplr newbies videosprofit funnelsecretstrading Top tags: sound effectsgames shopservice repair manualyamaha