download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
eBooks
Audio Books / Teaching
Movies
Educational
Video Tutorials
Software / Programs
Business
Education
Video Tutorials
Development
Templates / Flash


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Complete Marketing" downloads in ebooks

Thumbnail Ultimate Affiliate Marketing Secrets Pack+2 Mystery BONUSES!

Ultimate Affiliate Marketing Secrets Pack+2 Mystery Bonuses!

Get 14 HOT products on Affiliate Marketing, along with two Mystery BONUSES! If you want to make money from affiliate marketing,...
1. E-Magic Linker Software with An UNANNOUNCED BONUS
play button

3288.16 MB

Download
18.99 USD
Thumbnail Ultimate Youtube Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Youtube Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Youtube Marketing, along with two Mystery BONUSES! Listed below are the 9 products you will get...
1. YouTubeMarketing jtgt56u5u.zip
play button

850.2 MB

Download
9.99 USD
Thumbnail Ultimate Viral Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Viral Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Viral Marketing, along with two Mystery BONUSES! If you want to know how generate FREE traffic...
1. Exponential Profit Multiplier with 2 MYSTERY BO...
play button

627.02 MB

Download
15.99 USD
Thumbnail Ultimate Article Marketing Pack + 2 Mystery BONUSES!

Ultimate Article Marketing Pack + 2 Mystery Bonuses!

Get 12 HOT products on Article Marketing, along with two Mystery BONUSES! If you want to make money from article marketing...
1. ArticleMarketingCoursePLR ky86i86k.zip
play button

1118.18 MB

Download
15.99 USD
Thumbnail Ultimate Forum Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Forum Marketing Secrets Pack + 2 Mystery Bonuses!

Get 3 HOT products on Forum Marketing, along with two Mystery BONUSES! If you want to make money from forum marketing,...
1. ArticleMarketingCoursePLR ky86i86k.zip
play button

397.14 MB

Download
4.99 USD
Thumbnail Ultimate Niche Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Niche Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Niche Marketing, along with two Mystery BONUSES! If you want to make money from niche marketing,...
1. HowtoArticleDirPLR rkjy5y55.zip
play button

1902.93 MB

Download
12.99 USD
Thumbnail 30 HOT Reports - with FULL Private Label Rights + 2 BONUSES

30 Hot Reports - With Full Private Label Rights + 2 Bonuses

Comes with FULL Private Label Rights, and two Mystery BONUSES! Get 30 Smoking Hot Niche Reports - Complete With *FULL* Private...
1. Secret Marketing Strategies Volume 1
play button

12.18 MB

Download
6.99 USD
Thumbnail Ultimate Clickbank Marketing Secrets Pack+2 Mystery BONUSES!

Ultimate Clickbank Marketing Secrets Pack+2 Mystery Bonuses!

Get 9 HOT products on Clickbank Marketing, along with two Mystery BONUSES! If you want to make money from Clickbank, then...
1. 50ClickbankReviewPLR-jtf765f.zip
play button

582.3 MB

Download
11.99 USD
Thumbnail Ultimate Facebook Marketing Secrets Pack1 +2 Mystery BONUSES

Ultimate Facebook Marketing Secrets Pack1 +2 Mystery Bonuses

Get 5 HOT products on Facebook Marketing, along with two Mystery BONUSES! If you want to make money from Facebook marketing,...
1. DoingBusinessOnF h6y66yuuufd.zip
play button

684.61 MB

Download
7.99 USD
Thumbnail 39 Online Business E-book  Collection

39 Online Business E-book Collection

Get the 39 e-book collection for a very low price. This collection contains the following products: Instant Domain Cash PLR 5 Steps...
1. 5 Steps To Looking 10 Years Younger
play button

563.8 MB

Download
9.95 USD
Thumbnail Ultimate Video Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Video Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Video Marketing, along with two Mystery BONUSES! If you want to make money from video marketing,...
1. InternetMarketingAutoPLR ggg655j5j56.zip
play button

607.61 MB

Download
10.99 USD
Thumbnail Ultimate Web 2.0 Marketing Pack + 2 Mystery BONUSES!

Ultimate Web 2.0 Marketing Pack + 2 Mystery Bonuses!

Get 7 HOT products on Web 2.0 Marketing, along with two Mystery BONUSES! Listed below are the 7 products you will...
1. 21 Header Graphics Templates - FULLY Customizab...
play button

590.71 MB

Download
15.99 USD
Thumbnail Ultimate PPC Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Ppc Marketing Secrets Pack + 2 Mystery Bonuses!

Get 4 HOT products on Pay Per Click Marketing, along with two Mystery BONUSES! If you are interested in Pay Per...
1. GoogleAdwordsandAdsense kh7thn5756.zip
play button

73.4 MB

Download
3.99 USD

Similar tags: affiliate marketingarticle marketingbum marketing magicebookemailemail marketingforum marketing secretsinternetinternet marketingmake moneymarketingplrsecretstrafficvideovideo marketingvideo marketing secrets Top tags: sound effectsgames shopservice repair manualyamaha