download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
eBooks
Audio Books / Teaching
Music
MP3 (all)
Alternative
Classical
Country
Dance, Electronica
Hard Rock
Inspirational
Jazz, Blues, Funk
Lite Sounds
Pop
Rap, Hip Hop
RnB, Soul
Software / Programs
Development
Combination / Misc


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Interviewed" downloads in inspirational

Thumbnail MP3 Aliciadine - Even Now

Mp3 Aliciadine - Even Now

Revel this ANNOINTED, spirit-filled CD that will Sanctify YOUR SOUL.. ALICIADINE's rich rich stylings is compared to Anita Baker...
7.2 MB

Download
1.98 USD
Thumbnail MP3 Craig Amaker - Count It All Joy

Mp3 Craig Amaker - Count It All Joy

Urban title R+B, original, present-day gospel. Songs that minister the doctrine of our faith. Songs and lyrics that will prayerfully...
43.3 MB

Download
8.99 USD
Thumbnail MP3 Craig Amaker - By His Spirit

Mp3 Craig Amaker - By His Spirit

An annointed album full of testimonies, up-tempos, slow-tempos, revereful revere and praise. You must get this one.. 13 MP3 Songs GOSPEL: Present-day...
56.6 MB

Download
8.99 USD
Thumbnail MP3 Azure Fields - Higher Ground

Mp3 Azure Fields - Higher Ground

Higher Ground has an easy listening traditional sound with a touch of bluegrass 11 MP3 Songs GOSPEL: Traditional Gospel, COUNTRY: Country Folk Details: In...
34.1 MB

Download
8.99 USD
Thumbnail MP3 JoAnn Rose - Yoga Nidra

Mp3 Joann Rose - Yoga Nidra

Yoga Nidra is a superlative and powerful ancient deep relaxation sequence presented in a narrative form with ambient sounds. 1 MP3...
26.5 MB

Download
0.99 USD
Thumbnail MP3 Mary Brown - Standing for Jesus

Mp3 Mary Brown - Standing For Jesus

A collection of contemporary gospel songs written to uplift the listeners'' spirit. 10 MP3 Songs GOSPEL: Contemporary Gospel, EASY LISTENING: Background Mus......
39.6 MB

Download
8.99 USD
Thumbnail MP3 Delroy Souden - No Doubt

Mp3 Delroy Souden - No Doubt

Rhythm & Praise(R&P) from from the heart of one who knows what it is to go through. Experience the Passion,...
72.2 MB

Download
8.99 USD
Thumbnail MP3 Delroy Souden - Holy Fire

Mp3 Delroy Souden - Holy Fire

Uncompromised, uninhibited Urban Gospel Music from an artist with a style all his own. These songs are delivered from the...
15.8 MB

Download
3.96 USD
Thumbnail MP3 Alice Haines - Matter of Time

Mp3 Alice Haines - Matter Of Time

Alice''s music shines with the evoking sounds of multicultural influences, global nuances and personal interpretation that will amaze and engage...
48.3 MB

Download
8.99 USD

Similar tags: authorsbbo adwords formulacareer climbercharles burkee-businessebayebookfriends foundationinterviewedmarketingmp3 albumplanetportal systemsresellerrevealedskypeskype product secretsvideos skype audio Top tags: sound effectsgames shopservice repair manualyamaha