download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
eBooks
Audio Books / Teaching
Movies
Educational
Video Tutorials
Music
MP3 (all)
Jazz, Blues, Funk
Video Tutorials
Software / Programs
Business
Internet/Network
Video Tutorials
Sounds / MIDI
Loops
Development
PHP


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Massive Sale" downloads in software / programs

Thumbnail Instant Site Flipping Riches

Instant Site Flipping Riches

Average Joe Discovers Shockingly Simple But Powerful Secrets To Generate Massive Paydays From Flipping Brand New Websites! The Missing Link Between...

Download
3.90 USD
Thumbnail Listbuilding Renegade

Listbuilding Renegade

Are you ready to learn the renegade strategies for building massive lists of hungry buyers, as you sit back...

Download
3.90 USD
Thumbnail Social Niche Builder

Social Niche Builder

Who Else Would Like To Have MYSPACE or FACEBOOK Style Success, Including MILLIONS Of Advertising & Lead Generation Possiblities Not To...

Download
31.00 USD
Thumbnail Mega Software Collection

Mega Software Collection

This collection contains the following products: Article Analyzer Article Content Spinner Back link Flood Backup Wordpress Robot Digg Linker Easy 3D Ic......
1. Theme Creator
play button

98.7673 MB

Download
9.99 USD
Thumbnail Sniper List Building

Sniper List Building

YOU Can Learn MY Secrets For Building Your OWN HUGE, Responsive List Fast... WARNING: Dangerously Effective List Building Secrets May Cause...

Download
4.90 USD
Thumbnail Web Traffic collection

Web Traffic Collection

Explode your web traffic resources with this incredible products collection. This collection contains the following products: 20 days To More Traffic C......
1. Targeted Traffic Tips
play button

680.147 MB

Download
6.99 USD
Thumbnail Amazon Amazing Super Affiliate

Amazon Amazing Super Affiliate

Step By Step Guide Showing You One Of The Easiest And Most Effective Ways To Earn Online Today. Step By Step Guide To...

Download
5.50 USD
Thumbnail Profitable Blogging Secrests

Profitable Blogging Secrests

Stop Wasting Time With All The Half Baked Advice On Monetizing Blogs And Go With These Detailed Steps! Many Profit With...

Download
4.99 USD
Thumbnail Ebay Profit Pack

Ebay Profit Pack

Top Up Both Your PayPal & ClickBank Accounts Simultaneously & Earn A Massive 100 Commission Paid Instantly Into Your PayPal...

Download
9.99 USD
Thumbnail Writing Riches

Writing Riches

You Are About To Discover A Simple Business Model Where You Can Easily Earn Amazing Sums Of Cash! he top quality...

Download
3.49 USD
Thumbnail Pubblic Domain Fast

Pubblic Domain Fast

"Revealed : How To Earn A Massive Income From Freely Available Materials" Learn How To Create A 5 Or Even 6...

Download
3.50 USD
Thumbnail Wordpress Sofware Business Collection

Wordpress Sofware Business Collection

An incredible collection of 25 high quality products to know all the secrets about wordpress and to manage your wordpress...
1. MIcro-Merbership WP Plugin
play button

1221.05 MB

Download
7.99 USD
Thumbnail Self Publishing Revealed

Self Publishing Revealed

Step By Step Guide Explodes Publishing Myths And Reveals Simple Method To Earn From Publishing Your Own Physical Books The Self Publishing...

Download
9.00 USD
Thumbnail Viral Fan Page

Viral Fan Page

What is More Powerful Than Facebook Friends ? Facebook FANS Your Limitless Marketing Resource The script's creator says: "To help you tap...

Download
19.00 USD

Similar tags: affiliatecheap mrr downloadsclickbankdownloadebooksebooks for saleemail marketingfacebookhowtolist buildingmailing listmake money onlinemarketingmrrplrsecretstrafficyoutube Top tags: sound effectsgames shopservice repair manualyamaha