download process
Found in
Documents / eBooks
Manuals & Technical
MP3 (all)
Dance, Electronica
Hard Rock
Jazz, Blues, Funk


Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Pathfinder" downloads in music

Thumbnail MP3 Inviolet Row - Nevertheless

Mp3 Inviolet Row - Nevertheless

Whimsical, psychedelic "indie rock," richly shag-carpeted in melody, in the same broad vein as 70''s bowie, late beatles, and recent...
1. bellyful of butterfly knives
play button

36.1 MB

8.99 USD
Thumbnail MP3 S. Eric Scribner - (The) Nature [Of] Sound

Mp3 S. Eric Scribner - (the) Nature [of] Sound

Experimental/ambient electro-acoustic, often with homemade instruments and environmental sounds. 3 MP3 Songs in this album (57:25) ! Related styles: Avant G......
1. Phase Canon
play button

3 MB

8.99 USD
Thumbnail MP3 Inoculate - Inoculate

Mp3 Inoculate - Inoculate

9 MP3 Songs in this album (39:49) ! Related styles: Metal/Punk: Alternative Metal, Rock: Progressive Rock, Mood: Upbeat People who are interested...
1. Pathfinder
play button

9 MB

8.99 USD
Thumbnail MP3 Pathways - Heart Grenade

Mp3 Pathways - Heart Grenade

7 MP3 Songs in this album (21:00) ! Related styles: Metal/Punk: Metalcore, Metal/Punk: Post-Hardcore, Mood: Party Music People who are interested in...
1. Heart Grenade
play button

7 MB

8.99 USD
Thumbnail MP3 Chad K Slagle - Nights Like This

Mp3 Chad K Slagle - Nights Like This

Chad K. Slagle has created a following worldwide with his unique brand of folk/country that speaks to us like an...
1. The Last Wild Man
play button

39.5 MB

8.99 USD
Thumbnail MP3 Crown Of Glory - A Deep Breath Of Life

Mp3 Crown Of Glory - A Deep Breath Of Life

Melodic power metal with catchy hooklines and powerful guitars. 11 MP3 Songs in this album (61:55) ! Related styles: METAL/PUNK: Power Metal,...
1. The Calling
play button

11 MB

8.99 USD
Thumbnail MP3 Lounge Music - Instrumental Music, Vol. 1

Mp3 Lounge Music - Instrumental Music, Vol. 1

The range of ‚Lounge Music ‚ Vol.1 Instrumental Music‚ encompasses ‚Chillout Music‚ ‚ influenced instrumentals, modern electronica ‚ ‚Easy Listening...
1. Addicted
play button

10 MB

8.99 USD
Thumbnail MP3 Halo Effect - Recoding

Mp3 Halo Effect - Recoding

The italian job: Halo Effect started in the autumn of 2001, thanks to the union of different musical experiences. The atmosphere...
1. Cold Front
play button

14 MB

8.99 USD
Thumbnail MP3 Dense - Exhale

Mp3 Dense - Exhale

Besides working on "Tales From The Yellow Kangaroo" together with friend and fellow artist GMO, Dense used last summer to...
1. Silence (Dense Atmo Remix)
play button

9 MB

8.99 USD
Thumbnail MP3 Harris Van Berkel Group - Hello World

Mp3 Harris Van Berkel Group - Hello World

A blend of smooth jazz, funky grooves, some latin and blues featuring acoustic and electric guitar. 9 MP3 Songs JAZZ: Smooth Jazz,...
1. Hello World
play button

46.7 MB

8.99 USD
Thumbnail MP3 Blue 'Chaos' Light - Chapter I: Another Morning

Mp3 Blue 'chaos' Light - Chapter I: Another Morning

Emotional trance to emphasize your bright or night mood. 11 MP3 Songs in this album (53:13) ! Related styles: Electronic: Trance, Rock:...
1. Alpha Dream
play button

11 MB

8.99 USD
Thumbnail MP3 Canvas - Avenues

Mp3 Canvas - Avenues

Progressive power pop embracing the best of the past with an eye toward the future. 21 MP3 Songs ROCK: Progressive Rock, ROCK:...
1. Liberal Son
play button

104.3 MB

8.99 USD
Thumbnail MP3 Darkk Bros. - JAZZ: Acid Jazz

Mp3 Darkk Bros. - Jazz: Acid Jazz

"Ant-acid" jazz that also equally borrows from funk, rock and hip-hop. 10 MP3 Songs JAZZ: Acid Jazz, ROCK: Jam-band Details: Recommended if you like...
1. Dmj 3
play button

52.8 MB

8.99 USD
Thumbnail MP3 David Stevenson - Echoes Of An Inner Domain

Mp3 David Stevenson - Echoes Of An Inner Domain

Solo, nylon stringed instrumental guitar with some pieces using a digital delay echo effect 13 MP3 Songs NEW AGE: New Age, CLASSICAL:...
1. Song For a New Life
play button

37.6 MB

8.99 USD
Thumbnail MP3 Windows ?78 - The Window Seat

Mp3 Windows ?78 - The Window Seat

"Moody indie rock for robots on Mars." 10 MP3 Songs ROCK: Psychedelic, ROCK: Progressive Rock Details: It seems inevitable that THE WINDOW SEAT, the...
1. PAL
play button

39.3 MB

8.99 USD
Thumbnail MP3 Minister Fred II & The Stric'ly Jesus Camp - No More Dirty, Vol. 2

Mp3 Minister Fred Ii & The Stric'ly Jesus Camp - No More Dirty, Vol. 2

Its the perfect blend of Christian rap, Christian regge, Rythem & Praise, Christian Rock, Urban Gospel with a little contempory! 18...
1. He Got Me / Hostle Apostle (feat. Minister Fred...
play button

18 MB

8.99 USD
Thumbnail MP3 Lynne Taylor Donovan - Talk To Me

Mp3 Lynne Taylor Donovan - Talk To Me

"....this girl doesn''t sound like Wynette or Cline or any of the other country greats, she has a style and...
1. Talk To Me
play button

36.2 MB

8.99 USD
Thumbnail MP3 Inviolate - Feast of Ashes

Mp3 Inviolate - Feast Of Ashes

Frappée rock, metal, and industrial electronica at high intensity and add healthy hip shakes of bellydancing frontwoman. Sweeten or distort...
1. Condemned
play button

8 MB

8.99 USD
Thumbnail MP3 Idris Ackamoor - Centurian

Mp3 Idris Ackamoor - Centurian

Centurian is a jubiliant, empowering album that includes bits of Carribbean, funk, hip-hop, world music and straight ahead jazz and...
1. Libation Song
play button

55.7 MB

8.99 USD
Thumbnail MP3 Idris Ackamoor - Homage to Cuba

Mp3 Idris Ackamoor - Homage To Cuba

Idris Ackamoor pays tribute to the Afro-Caribbean music of Cuba embracing modern jazz and world rhythms to create a glorious...
1. Santeria
play button

60.9 MB

8.99 USD

Similar tags: bodyfictiongeneralhistoryjames fenimore cooperlindemanualmilitarymindmp3 albumnissannokiapathfinderrepairservicespiritworkshop manualworld war ii Top tags: sound effectsgames shopservice repair manualyamaha