download process

"Trademark" downloads in movies

Thumbnail LTBz FL Studio Starter Kit - Collection of 12 files

Ltbz Fl Studio Starter Kit - Collection Of 12 Files

This collection contains the following products: CRACK MUZIK VOL 1: Synths Drums Wavs CrAcK MuZiK VoL 2: Instrument Wavs Dre Dirty South Shady...
1. LTBz Fruity Loops Tutorial + Samples
play button

1149.71 MB

54 USD
Thumbnail The Flying Deuces (1939)

The Flying Deuces (1939)

Stars: Stan Laurel, Oliver Hardy and Jean Parker. In one of the most far-fetched plots they ever filmed, the two men...

4.65 USD
Thumbnail Public Domain Treasures with MRR

Public Domain Treasures With Mrr

Public Domain Treasures with MRR. Dear Entrepreneur. This package Contains: https://www.tradebit.comok https://www.tradebit.come https://www.t......

4.99 USD
Thumbnail cPanel 4 Newbies

Cpanel 4 Newbies

cPanel, Cron Jobs, Fantastico, Awstats.. All Sound Like Another Language.. "Does The Thought Of Tweaking And 'Playing Around' With Your Server...

9.99 USD
Thumbnail Articles 4 Newbies

Articles 4 Newbies

Free Traffic, One-Time Setup, Lifetime Visitors!.. Use Article Marketing To Explode Your Business! Today You Will Learn Everything You Need To...

4.99 USD
Thumbnail Kids Toy Chest

Kids Toy Chest

Cash in on ClickBank with the childrens toy niche. Contents include eBooks, videos, articles, etc.File Size: 1082.01 MBReseller kit included?...

6.25 USD
Thumbnail Ultimate Blogging Secrets Pack2 + 2 Mystery BONUSES!

Ultimate Blogging Secrets Pack2 + 2 Mystery Bonuses!

Get 10 HOT products on Blogging, along with two Mystery BONUSES! If you want to know how to make money from...
1. WordPress AutoBlogging Script with An UNANNOUNC...
play button

1795.5 MB

16.99 USD

Similar tags: artichokecountry: country rockdrinkfoodfruitgeneralintellectual propertyisolatedlawmanualmood: party musicmood: upbeatmp3 albummushroompastrytrademarktrademarkingvegetable Top tags: sound effectsgames shopservice repair manualyamaha