download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
Entertainment
eBooks
Recipes & Cooking
Music
MP3 (all)
Alternative
Classical
Dance, Electronica
Hard Rock
Jazz, Blues, Funk
Lite Sounds
Podcasts, Audibles
Pictures / Graphics
Abstract
Nature
People
Animals
Family Crests
Software / Programs
Miscellaneous
Utilities


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Trout" downloads

Thumbnail Articles: 6/2014 (pt 2)

Articles: 6/2014 (pt 2)

"Article Writing, Auto Warranties, Back Surgery, Cheap Travel, Deer Ticks, Fast Food, Flea Control, Public Domain, Summer Fun, Summer Grilling,...

Download
7.00 USD
Thumbnail MP3 Kilgore Trout - Three

Mp3 Kilgore Trout - Three

Modern Rock 3 MP3 Songs ROCK: Modern Rock, ROCK: Progressive Rock Details: When growling guitars echo with innocent integrity and your soul is warmed...
9.3 MB

Download
2.97 USD
Thumbnail Freshly caught trout on the grill

Freshly Caught Trout On The Grill

Photography: Freshly caught trout on the grill Author: ulrich niehoffDate: 2008-04-12 Maximum available size: 18.2 Mpix.(5231 x 3474 pix.) Lowest (724x......

Download
49.00 EUR (57.37 USD)
Thumbnail trout in a frying pan

Trout In A Frying Pan

Photografie: trout in a frying pan Author: Alfred Schauhuber Date: 2006-08-25 Maximum available size: 18.3 Mpix.(5241 x 3494 pix.) Lowest (724x46......

Download
49.00 EUR (57.37 USD)
Thumbnail Trout with vegetable ratatouille

Trout With Vegetable Ratatouille

Photo cd: Trout with vegetable ratatouille Author: ZAM-PhotographyDate: 2010-04-06 Royalty Free photo versions - Maximum available size: 21.4 Mpix.(4008 x......

Download
49.00 EUR (57.37 USD)
Thumbnail MP3 Tammy Trout - Suddenly

Mp3 Tammy Trout - Suddenly

A soulful mix of inspirational ballads and energetic christian worship music. Easy listening smooth vocals mixed with Nashvilles top players...
12 MB

Download
8.99 USD

Similar tags: aboveamericacampingdaylightfishfishingfly fishingfoodgeneralgrillmp3 albumnatureoutdoorrecipesrecreationsportstradebittrout Top tags: sound effectsgames shopservice repair manualyamaha