download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
eBooks
Audio Books / Teaching
Movies
Video Tutorials
Music
MP3 (all)
Video Tutorials
Pictures / Graphics
Miscellaneous
Software / Programs
Business
Video Tutorials
Development
PHP
Perl / CGI
Templates / Flash
Misc.


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Viral Email Marketing" downloads in ebooks

Thumbnail Email marketing PLR ebooks package

Email Marketing Plr Ebooks Package

This collection contains the following products: Opt In List Building For Beginners - New ebook with PLR Maillist Cash Extraction Goldmine -...
1. List Building StrategiesThat Really Work - New ...
play button

5.49 MB

Download
5.98 USD
Thumbnail Ultimate Viral Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Viral Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Viral Marketing, along with two Mystery BONUSES! If you want to know how generate FREE traffic...
1. Exponential Profit Multiplier with 2 MYSTERY BO...
play button

627.02 MB

Download
15.99 USD
Thumbnail Ultimate Facebook Marketing Secrets Pack2 +2 Mystery BONUSES

Ultimate Facebook Marketing Secrets Pack2 +2 Mystery Bonuses

Get 7 HOT products on Facebook Marketing, along with two Mystery BONUSES! If you want to make money from Facebook marketing,...
1. Facebook Cash Cow+BONUS!
play button

626.43 MB

Download
8.99 USD
Thumbnail 39 Online Business E-book  Collection

39 Online Business E-book Collection

Get the 39 e-book collection for a very low price. This collection contains the following products: Instant Domain Cash PLR 5 Steps...
1. 5 Steps To Looking 10 Years Younger
play button

563.8 MB

Download
9.95 USD
Thumbnail Ultimate Niche Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Niche Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Niche Marketing, along with two Mystery BONUSES! If you want to make money from niche marketing,...
1. HowtoArticleDirPLR rkjy5y55.zip
play button

1902.93 MB

Download
12.99 USD
Thumbnail 32 Internet Marketing PLR ebooks Package - Save HUGE!

32 Internet Marketing Plr Ebooks Package - Save Huge!

This collection contains the following products: Affiliate Marketers Handbook - New ebook with PLR Affiliate Marketing A To Z - New ebook...
1. Web 2.0 Sites Exposed - New ebook with PLR
play button

43.42 MB

Download
7.99 USD
Thumbnail Ultimate Ebay Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Ebay Marketing Secrets Pack + 2 Mystery Bonuses!

Get 5 HOT products on Ebay Marketing, along with two Mystery BONUSES! If you want to make money from Ebay marketing,...
1. HowSellDomainsEbayPLR 5j57575y.zip
play button

53.51 MB

Download
4.99 USD
Thumbnail Ultimate Networking Marketing Secrets Pack+2 Mystery BONUSES

Ultimate Networking Marketing Secrets Pack+2 Mystery Bonuses

Get 8 HOT products on Networking Marketing, along with two Mystery BONUSES! If you want to make money from networking marketing...
1. NetworkMarketingplr iou7t5r5r5.zip
play button

97.82 MB

Download
10.99 USD
Thumbnail 3 PRO Internet Marketing Guides for Newbies - with 2 BONUSES

3 Pro Internet Marketing Guides For Newbies - With 2 Bonuses

Comes with two Mystery BONUSES! Get 3 High Quality Reports! All the reports come in .PDF format! List of Reports You Will...
1. Master Affiliate Marketing In 7 Easy-To-Follow ...
play button

10.46 MB

Download
2.99 USD
Thumbnail Ultimate Domain Name Marketing Secrets Pack+Mystery BONUSES!

Ultimate Domain Name Marketing Secrets Pack+mystery Bonuses!

Get 4 HOT products on Domain Name Marketing, along with two Mystery BONUSES! If you want to make money from domain...
1. HowSellDomainsEbayPLR 5j57575y.zip
play button

143.03 MB

Download
4.99 USD
Thumbnail Collection of 22 files

Collection Of 22 Files

This collection contains the following products: Affiliate Fire Extinguisher (With MRR) Digital Product Creation & Outsourcing 101 (with MRR) Dominate The......
1. Web Traffic Flood (With MRR)
play button

74.4481 MB

Download
48.87 USD
Thumbnail Viral Marketing Mania

Viral Marketing Mania

Who Else Wants To Know How To Exponentially Grow Your Online Business Using The Power Of Viral Marketing? Explode Your Traffic...

Download
5.95 USD
Thumbnail Viral Marketing Riches

Viral Marketing Riches

If you‘re sick and tired of doing all the marketing and advertising on your own... "Discover How YOU Can Make...

Download
3.65 USD

Similar tags: articlearticle marketinge-marketingemailemail marketinginternet marketinginternet marketing how tolist buildingmake moneymake money onlinemarketingonline marketingplrsecretstrafficvideo marketingviral marketing Top tags: sound effectsgames shopservice repair manualyamaha