download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
Entertainment
eBooks
Audio Books / Teaching
Movies
Video Tutorials
Software / Programs
Business
Video Tutorials
Misc.


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Viral Marketing Strategies" downloads in ebooks

Thumbnail 30 HOT Reports - with FULL Private Label Rights + 2 BONUSES

30 Hot Reports - With Full Private Label Rights + 2 Bonuses

Comes with FULL Private Label Rights, and two Mystery BONUSES! Get 30 Smoking Hot Niche Reports - Complete With *FULL* Private...
1. Secret Marketing Strategies Volume 1
play button

12.18 MB

Download
6.99 USD
Thumbnail Ultimate Viral Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Viral Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Viral Marketing, along with two Mystery BONUSES! If you want to know how generate FREE traffic...
1. Exponential Profit Multiplier with 2 MYSTERY BO...
play button

627.02 MB

Download
15.99 USD
Thumbnail Email marketing PLR ebooks package

Email Marketing Plr Ebooks Package

This collection contains the following products: Opt In List Building For Beginners - New ebook with PLR Maillist Cash Extraction Goldmine -...
1. List Building StrategiesThat Really Work - New ...
play button

5.49 MB

Download
5.98 USD
Thumbnail Ultimate PLR Marketing Secrets Package + 2 Mystery BONUSES!

Ultimate Plr Marketing Secrets Package + 2 Mystery Bonuses!

Get 6 HOT products on "Private Label Rights" Marketing, along with two Mystery BONUSES! If you want to make money from...
1. HowToUseClickB ijygrrf5r5.zip
play button

61.61 MB

Download
5.99 USD
Thumbnail Ultimate Facebook Marketing Secrets Pack1 +2 Mystery BONUSES

Ultimate Facebook Marketing Secrets Pack1 +2 Mystery Bonuses

Get 5 HOT products on Facebook Marketing, along with two Mystery BONUSES! If you want to make money from Facebook marketing,...
1. DoingBusinessOnF h6y66yuuufd.zip
play button

684.61 MB

Download
7.99 USD
Thumbnail 39 Online Business E-book  Collection

39 Online Business E-book Collection

Get the 39 e-book collection for a very low price. This collection contains the following products: Instant Domain Cash PLR 5 Steps...
1. 5 Steps To Looking 10 Years Younger
play button

563.8 MB

Download
9.95 USD
Thumbnail Ultimate Youtube Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Youtube Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Youtube Marketing, along with two Mystery BONUSES! Listed below are the 9 products you will get...
1. YouTubeMarketing jtgt56u5u.zip
play button

850.2 MB

Download
9.99 USD
Thumbnail Ultimate Niche Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Niche Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Niche Marketing, along with two Mystery BONUSES! If you want to make money from niche marketing,...
1. HowtoArticleDirPLR rkjy5y55.zip
play button

1902.93 MB

Download
12.99 USD
Thumbnail Ultimate Video Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Video Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Video Marketing, along with two Mystery BONUSES! If you want to make money from video marketing,...
1. InternetMarketingAutoPLR ggg655j5j56.zip
play button

607.61 MB

Download
10.99 USD
Thumbnail 12 Niche Products - with No Restriction PLR + MYSTERY BONUS

12 Niche Products - With No Restriction Plr + Mystery Bonus

Comes with FULL Private Label Rights, and a Mystery BONUS! Get 12 BRAND NEW, Smoking Hot Info Products - All Targeted...
1. InternetSecurity j6nt7h6y.zip
play button

126.11 MB

Download
7.99 USD
Thumbnail Viral Marketing Mania

Viral Marketing Mania

Who Else Wants To Know How To Exponentially Grow Your Online Business Using The Power Of Viral Marketing? Explode Your Traffic...

Download
5.95 USD
Thumbnail Viral Marketing Mania PLR Book

Viral Marketing Mania Plr Book

RE: Exponentially Growing Your Online Business Dear Respected Marketer, Leverage is the one key that lets people do more with less. We...

Download
9.99 USD
Thumbnail Ultimate Networking Marketing Secrets Pack+2 Mystery BONUSES

Ultimate Networking Marketing Secrets Pack+2 Mystery Bonuses

Get 8 HOT products on Networking Marketing, along with two Mystery BONUSES! If you want to make money from networking marketing...
1. NetworkMarketingplr iou7t5r5r5.zip
play button

97.82 MB

Download
10.99 USD
Thumbnail Ultimate PPC Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Ppc Marketing Secrets Pack + 2 Mystery Bonuses!

Get 4 HOT products on Pay Per Click Marketing, along with two Mystery BONUSES! If you are interested in Pay Per...
1. GoogleAdwordsandAdsense kh7thn5756.zip
play button

73.4 MB

Download
3.99 USD
Thumbnail Ultimate Domain Name Marketing Secrets Pack+Mystery BONUSES!

Ultimate Domain Name Marketing Secrets Pack+mystery Bonuses!

Get 4 HOT products on Domain Name Marketing, along with two Mystery BONUSES! If you want to make money from domain...
1. HowSellDomainsEbayPLR 5j57575y.zip
play button

143.03 MB

Download
4.99 USD

Similar tags: article marketingbusinessinternet marketingmake moneymarketingsecretstrafficvideovideo marketingvideo marketing secretsviralviral marketingviral trafficweb trafficyou canyoutube Top tags: sound effectsgames shopservice repair manualyamaha