download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
eBooks
Audio Books / Teaching
Movies
Video Tutorials
Music
MP3 (all)
Video Tutorials
Software / Programs
Business
Website Promotion
Development
PHP


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Viral Marketing Tactic" downloads in documents / ebooks

Thumbnail Ultimate Viral Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Viral Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Viral Marketing, along with two Mystery BONUSES! If you want to know how generate FREE traffic...
1. Exponential Profit Multiplier with 2 MYSTERY BO...
play button

627.02 MB

Download
15.99 USD
Thumbnail Ultimate Video Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Video Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Video Marketing, along with two Mystery BONUSES! If you want to make money from video marketing,...
1. InternetMarketingAutoPLR ggg655j5j56.zip
play button

607.61 MB

Download
10.99 USD
Thumbnail Ultimate Youtube Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Youtube Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Youtube Marketing, along with two Mystery BONUSES! Listed below are the 9 products you will get...
1. YouTubeMarketing jtgt56u5u.zip
play button

850.2 MB

Download
9.99 USD
Thumbnail Collection of 22 files

Collection Of 22 Files

This collection contains the following products: Affiliate Fire Extinguisher (With MRR) Digital Product Creation & Outsourcing 101 (with MRR) Dominate The......
1. Web Traffic Flood (With MRR)
play button

74.4481 MB

Download
48.87 USD
Thumbnail The Viral Marketing Effect with MRR

The Viral Marketing Effect With Mrr

Find Out How to Successfully Create the Positive Buzz that Attracts Attention! Harnessing the Power of Viral Marketing Where Everyone is...

Download
6.99 USD
Thumbnail 133 eBooks with master resell rights/mrr SAVE $330

133 Ebooks With Master Resell Rights/mrr Save $330

Normal price individually $354.89 collection price with the exact same products: JUST $19.99 Save more than $330 and buy this collection...
1. The complete guide to making money online mrr +...
play button

66.4393 MB

Download
23.99 USD
Thumbnail Viral Marketing Riches

Viral Marketing Riches

If you‘re sick and tired of doing all the marketing and advertising on your own... "Discover How YOU Can Make...

Download
3.65 USD

Similar tags: cheapdomain nameseasyebookebookseprofit generatorexpired domain fortunesexpired domainsexpired domains fortunesinternet marketingmake money onlinemarketingscripttrafficvideoviralviral marketingyoutube Top tags: sound effectsgames shopservice repair manualyamaha