download process
Found in
Documents / eBooks
Business
Manuals & Technical
eBooks
Audio Books / Teaching
Movies
Educational
Video Tutorials
Software / Programs
Business
Internet/Network
Video Tutorials
Development
PHP


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Secrets Marketing" downloads

Thumbnail 7 Products In 7 Days

7 Products In 7 Days

Amazing Secrets Of Warp Speed Product Creation! If you've ever wanted to get a little sneaky peak...

Download
6.25 USD
Thumbnail Ultimate Forum Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Forum Marketing Secrets Pack + 2 Mystery Bonuses!

Get 3 HOT products on Forum Marketing, along with two Mystery BONUSES! If you want to make money from forum marketing,...
1. ArticleMarketingCoursePLR ky86i86k.zip
play button

397.14 MB

Download
4.99 USD
Thumbnail Ultimate PPC Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Ppc Marketing Secrets Pack + 2 Mystery Bonuses!

Get 4 HOT products on Pay Per Click Marketing, along with two Mystery BONUSES! If you are interested in Pay Per...
1. GoogleAdwordsandAdsense kh7thn5756.zip
play button

73.4 MB

Download
3.99 USD
Thumbnail 18 Internet Marketing Ebooks and Software PAK #1 Save BIG!

18 Internet Marketing Ebooks And Software Pak #1 Save Big!

This collection contains the following products: Forum Traffic Secrets - Drive Quality Traffic to your Website in Minutes Email Marketing...
1. **NEW* Product Launch 1... 2... 3... - Be Succe...
play button

41.7411 MB

Download
5.98 USD
Thumbnail Ultimate Mindset Secrets Pack + 2 Mystery BONUSES!

Ultimate Mindset Secrets Pack + 2 Mystery Bonuses!

Get 14 HOT products on Offline Marketing, along with two Mystery BONUSES! Do you want to be successful in business? Then...
1. EntrepreneurSuccessMindsetPLR it85y76.zip
play button

677.39 MB

Download
17.99 USD
Thumbnail Ultimate Public Domain Secrets Pack + 2 Mystery BONUSES!

Ultimate Public Domain Secrets Pack + 2 Mystery Bonuses!

Get 4 HOT products on Public Domain, along with two Mystery BONUSES! If you want to make money from public domain,...
1. HowToProfitFromPublicDomain gmgh6mn6.zip
play button

278.507 MB

Download
5.99 USD
Thumbnail Email marketing PLR ebooks package

Email Marketing Plr Ebooks Package

This collection contains the following products: Opt In List Building For Beginners - New ebook with PLR Maillist Cash Extraction Goldmine -...
1. List Building StrategiesThat Really Work - New ...
play button

5.49 MB

Download
5.98 USD
Thumbnail 26 Ebook and Audio Book PKG 2 - bargainhunterwarehouse.com

26 Ebook And Audio Book Pkg 2 - Bargainhunterwarehouse.com

This collection contains the following products: 7 Days To PLR Profits ( Bargain Hunter Warehouse ) 30 Day Bum Marketing Blitz +...
1. Secrets To Looking & Feeling Younger
play button

211.483 MB

Download
53.95 USD
Thumbnail Ultimate Viral Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Viral Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Viral Marketing, along with two Mystery BONUSES! If you want to know how generate FREE traffic...
1. Exponential Profit Multiplier with 2 MYSTERY BO...
play button

627.02 MB

Download
15.99 USD
Thumbnail Ultimate Affiliate Marketing Secrets Pack+2 Mystery BONUSES!

Ultimate Affiliate Marketing Secrets Pack+2 Mystery Bonuses!

Get 14 HOT products on Affiliate Marketing, along with two Mystery BONUSES! If you want to make money from affiliate marketing,...
1. E-Magic Linker Software with An UNANNOUNCED BONUS
play button

3288.16 MB

Download
18.99 USD
Thumbnail Ultimate JV (Joint Venture) Secrets Pack + 2 Mystery BONUSES

Ultimate Jv (joint Venture) Secrets Pack + 2 Mystery Bonuses

Get 4 HOT products on JV (Joint Venture), along with two Mystery BONUSES! If you want to make money from JV...
1. JVPartnershipsPLR hkyi86j68y.zip
play button

42.82 MB

Download
3.99 USD

Similar tags: affiliatearticle marketingebookforum marketing secretsinstant video marketinginternetinternet marketingmarketingmarketing secretsnewbiesonline marketingplrsecretstrafficvideo marketingvideo marketing secretsviral marketing Top tags: sound effectsgames shopservice repair manualyamaha