download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
eBooks
Audio Books / Teaching
Movies
Video Tutorials
Music
MP3 (all)
Jazz, Blues, Funk
Software / Programs
Business
Internet/Network
Video Tutorials
Development
Combination / Misc


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Very Value Contents" downloads in ebooks

Thumbnail Ultimate Mindset Secrets Pack + 2 Mystery BONUSES!

Ultimate Mindset Secrets Pack + 2 Mystery Bonuses!

Get 14 HOT products on Offline Marketing, along with two Mystery BONUSES! Do you want to be successful in business? Then...
1. EntrepreneurSuccessMindsetPLR it85y76.zip
play button

677.39 MB

Download
17.99 USD
Thumbnail Ultimate List Building Pack + 2 Mystery BONUSES

Ultimate List Building Pack + 2 Mystery Bonuses

Get 19 HOT List Building Products, along with two Mystery BONUSES! Listed below are the 19 list building products you will...
1. KultKingdomplr jr64yg6r.zip
play button

2136.66 MB

Download
29.99 USD
Thumbnail Ultimate Ebay Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Ebay Marketing Secrets Pack + 2 Mystery Bonuses!

Get 5 HOT products on Ebay Marketing, along with two Mystery BONUSES! If you want to make money from Ebay marketing,...
1. HowSellDomainsEbayPLR 5j57575y.zip
play button

53.51 MB

Download
4.99 USD
Thumbnail Ultimate PLR Marketing Secrets Package + 2 Mystery BONUSES!

Ultimate Plr Marketing Secrets Package + 2 Mystery Bonuses!

Get 6 HOT products on "Private Label Rights" Marketing, along with two Mystery BONUSES! If you want to make money from...
1. HowToUseClickB ijygrrf5r5.zip
play button

61.61 MB

Download
5.99 USD
Thumbnail Ultimate Traffic Generation Secrets Pack1+2 Mystery BONUSES

Ultimate Traffic Generation Secrets Pack1+2 Mystery Bonuses

Get 12 HOT products on Traffic Generation, along with two Mystery BONUSES! If you want to know how to generate traffic...
1. MyspacePromotionPLR gkg7tjt76.zip
play button

1681.11 MB

Download
15.99 USD
Thumbnail Ultimate Affiliate Marketing Secrets Pack+2 Mystery BONUSES!

Ultimate Affiliate Marketing Secrets Pack+2 Mystery Bonuses!

Get 14 HOT products on Affiliate Marketing, along with two Mystery BONUSES! If you want to make money from affiliate marketing,...
1. E-Magic Linker Software with An UNANNOUNCED BONUS
play button

3288.16 MB

Download
18.99 USD
Thumbnail Ultimate Outsourcing Secrets Pack + 2 Mystery BONUSES!

Ultimate Outsourcing Secrets Pack + 2 Mystery Bonuses!

Get 8 HOT products on Outsourcing, along with two Mystery BONUSES! If you are interested in outsourcing some or ALL of...
1. HowtoOutsourceplr fjfy45y54y54.zip
play button

226.01 MB

Download
10.99 USD
Thumbnail Ultimate Law of Attraction Secrets Pack + 2 Mystery BONUSES!

Ultimate Law Of Attraction Secrets Pack + 2 Mystery Bonuses!

Get 6 HOT products on Law of Attraction, along with two Mystery BONUSES! Listed below are the 6 products you will...
1. HealthandWealthplr rjr6g55454.zip
play button

523.58 MB

Download
7.99 USD
Thumbnail Ultimate Cost Per Action (CPA) Pack - with 2 Mystery BONUSES

Ultimate Cost Per Action (cpa) Pack - With 2 Mystery Bonuses

Get 10 HOT products on CPA marketing, along with two Mystery BONUSES! If you want to make money from cost per...
1. 1 bonuses.zip
play button

104.71 MB

Download
11.99 USD
Thumbnail Ultimate Domain Name Marketing Secrets Pack+Mystery BONUSES!

Ultimate Domain Name Marketing Secrets Pack+mystery Bonuses!

Get 4 HOT products on Domain Name Marketing, along with two Mystery BONUSES! If you want to make money from domain...
1. HowSellDomainsEbayPLR 5j57575y.zip
play button

143.03 MB

Download
4.99 USD
Thumbnail Ultimate Networking Marketing Secrets Pack+2 Mystery BONUSES

Ultimate Networking Marketing Secrets Pack+2 Mystery Bonuses

Get 8 HOT products on Networking Marketing, along with two Mystery BONUSES! If you want to make money from networking marketing...
1. NetworkMarketingplr iou7t5r5r5.zip
play button

97.82 MB

Download
10.99 USD
Thumbnail 12 Niche Products - with No Restriction PLR + MYSTERY BONUS

12 Niche Products - With No Restriction Plr + Mystery Bonus

Comes with FULL Private Label Rights, and a Mystery BONUS! Get 12 BRAND NEW, Smoking Hot Info Products - All Targeted...
1. InternetSecurity j6nt7h6y.zip
play button

126.11 MB

Download
7.99 USD

Similar tags: affiliate marketingbusinesscashclick bank atmclickbankclickbank atmdownloadebooksmake moneymake money onlinemake more moneymarketingmrrpackageplrprivate label rightssecretstradebit Top tags: sound effectsgames shopservice repair manualyamaha