download process
Found in
Documents / eBooks
Business
Manuals & Technical
Educational
eBooks
Audio Books / Teaching
Movies
Video Tutorials
Music
MP3 (all)
Video Tutorials
Software / Programs
Business
Website Promotion
Development
PHP


Shopper Award

Publish

Merchants on tradebit get a free subdomain with their account - fully customizable
Sign up

"Viral Marketing Tactic" downloads

Thumbnail Collection of 22 files

Collection Of 22 Files

This collection contains the following products: Affiliate Fire Extinguisher (With MRR) Digital Product Creation & Outsourcing 101 (with MRR) Dominate The......
1. Web Traffic Flood (With MRR)
play button

74.4481 MB

Download
48.87 USD
Thumbnail Ultimate Viral Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Viral Marketing Secrets Pack + 2 Mystery Bonuses!

Get 11 HOT products on Viral Marketing, along with two Mystery BONUSES! If you want to know how generate FREE traffic...
1. Exponential Profit Multiplier with 2 MYSTERY BO...
play button

627.02 MB

Download
15.99 USD
Thumbnail 520 PLR-MRR-RR Ebooks, Training Videos, Plugins, Niche Blogs

520 Plr-mrr-rr Ebooks, Training Videos, Plugins, Niche Blogs

520 PLR - MRR - RR Ebooks, Training Videos, Plugins, Niche Blogs.. and much more! worth $120,96 here on Tradebit,...
1. 19 Amazing High Quality must have Wordpress Plu...
play button

35363.2 MB

Download
9.97 USD
Thumbnail Easy Ebook Money - MRR

Easy Ebook Money - Mrr

"Discover The Secrets To Creating Fast Selling, Profit Packed, Info Products That Sell Like Crazy!" Even If You Hate Writing And...

Download
4.95 USD
Thumbnail Viral Marketing Riches

Viral Marketing Riches

Viral Marketing Riches If you're sick and tired of doing all the marketing and advertising on your own... "Discover How YOU Can...

Download
12.00 USD
Thumbnail Traffic Avalanche Secrets

Traffic Avalanche Secrets

Dear fellow Internet Marketer, Im sure youre quite skeptical right now, but give my just 5 minutes, and Ill reveal to...

Download
3.96 USD
Thumbnail Ultimate Youtube Marketing Secrets Pack + 2 Mystery BONUSES!

Ultimate Youtube Marketing Secrets Pack + 2 Mystery Bonuses!

Get 9 HOT products on Youtube Marketing, along with two Mystery BONUSES! Listed below are the 9 products you will get...
1. YouTubeMarketing jtgt56u5u.zip
play button

850.2 MB

Download
9.99 USD

Similar tags: easyebookebookseprofit generatorexpired domain fortunesexpired domainsexpired domains fortunesinternet marketingmake money onlinemarketingscriptsecretstrafficvideoviralviral marketingyoutube Top tags: sound effectsgames shopservice repair manualyamaha